SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167034692|ref|YP_001669923.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167034692|ref|YP_001669923.1|
Domain Number 1 Region: 219-685
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 1.23e-79
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00043
Further Details:      
 
Domain Number 2 Region: 82-213
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 4.02e-33
Family Ferredoxin domains from multidomain proteins 0.00027
Further Details:      
 
Domain Number 3 Region: 1-77
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 3.01e-18
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.033
Further Details:      
 
Weak hits

Sequence:  gi|167034692|ref|YP_001669923.1|
Domain Number - Region: 809-886
Classification Level Classification E-value
Superfamily ADC-like 0.000157
Family Formate dehydrogenase/DMSO reductase, C-terminal domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|167034692|ref|YP_001669923.1|
Sequence length 904
Comment NADH dehydrogenase subunit G [Pseudomonas putida GB-1]
Sequence
MATIHVDGKALEVNGADNLLQACLSLGLDIPYFCWHPALGSVGACRQCAVKQYTDENDTR
GRIVMSCMTPASDGTWISIEDEESKAFRASVVEWLMTNHPHDCPVCEEGGHCHLQDMTVM
TGHNERRYRFTKRTHQNQDLGPFIAHEMNRCIACYRCVRYYKDYAGGTDLGVYGAHDNVY
FGRVEDGVLESEFSGNLTEVCPTGVFTDKTHSERYNRKWDMQFAPSICHGCSSGCNISPG
ERYGELRRIENRFNGSVNQYFLCDRGRFGYGYVNRKDRPRQPHLADGTKLGLDAALDKAA
DLLRGRTIVGIGSPRASLESNYGLRELVGAEYFYSGMEAGELARVRLALNVLNNSPLPVP
TLRDIEDHDAVFVLGEDLTQTAARVALAVRQATKGKAEAMAEAMKVQPWLDAAVKNIGQH
ALYPLFIASLAETKLDDVAEECVHAAPADLARIGFAVAHAIDPSAPAVAGLDDEAKALAQ
RIADALVAAKRPLVVAGTSLADPALIEAAANIAKALKLREKNGSLSLVVPEANSIGLAML
GGESVDAALDAVISGKADAIVVLENDLYARVPAAKVDAALAAAKVVIVADHSKTPTVDRA
HLVLPAASFAEGDGTLVSQEGRAQRFFQVFDPQYLDSSIQIHEGWRWMHALRATLLNKPV
DWTQLDHVTSACAEAAPQLAGIVNAAPSAAFRIKGMKLAREPLRYSGRTAMRANISVHEP
RTPQDKDTAFAFSMEGYSGSAEPRQQVPFAWSPGWNSPQAWNKFQDEVGGHLRAGDPGVR
LIESQGDRLNWFNAIPGAFNPARGTWTAVPFFHLFGSEESSSRAAPVQQRIPAAYVALAK
SEADRLGVNDGAMLSLNVAGVALRLPLRINEELGAGLVALPKGLAGIPPAIFGASVEGLQ
EAAQ
Download sequence
Identical sequences B0KMY3
76869.PputGB1_3696 gi|167034692|ref|YP_001669923.1| WP_012273296.1.13892 WP_012273296.1.65540 WP_012273296.1.81634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]