SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167034756|ref|YP_001669987.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167034756|ref|YP_001669987.1|
Domain Number 1 Region: 104-231
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 1.45e-38
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.00000196
Further Details:      
 
Domain Number 2 Region: 2-103
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.84e-24
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0000246
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|167034756|ref|YP_001669987.1|
Sequence length 234
Comment succinate dehydrogenase iron-sulfur subunit [Pseudomonas putida GB-1]
Sequence
MLKVEVYRYNPDTDSAPKMESFDVDTGGKDLMVLDVLALIKEKDEGFSYRRSCREGVCGS
DGMNMNGKNGLACITPLSAVVKGGKLVLRPLPGLPVIRDLVVDMSIFYKQYEKVKPFLQN
DTPAPAIERLQSPEDRDKLDGLYECILCACCSTSCPSFWWNPDKFLGPAALLQAYRFLAD
SRDTKTQERLASLDDPFSVFRCRGIMNCVNVCPKGLNPTKAIGHVRNMLLQSGT
Download sequence
Identical sequences A0A0A7PRP0 A0A168WKK1 A0A173HIB7 A0A179R1J2 A0A2I0CE58 A0A2K4LD94 A5W110 B0KNX2 I3V0R4 I7C3K8 Q88FA8
160488.PP_4190 351746.Pput_1664 76869.PputGB1_3761 NP_746307.1.35174 WP_003254212.1.100978 WP_003254212.1.1079 WP_003254212.1.11138 WP_003254212.1.13892 WP_003254212.1.25319 WP_003254212.1.25626 WP_003254212.1.28295 WP_003254212.1.28475 WP_003254212.1.3142 WP_003254212.1.31851 WP_003254212.1.32932 WP_003254212.1.33269 WP_003254212.1.33725 WP_003254212.1.34900 WP_003254212.1.35996 WP_003254212.1.41 WP_003254212.1.42045 WP_003254212.1.44137 WP_003254212.1.47320 WP_003254212.1.48025 WP_003254212.1.52680 WP_003254212.1.54657 WP_003254212.1.5613 WP_003254212.1.58218 WP_003254212.1.60844 WP_003254212.1.62773 WP_003254212.1.65540 WP_003254212.1.66485 WP_003254212.1.675 WP_003254212.1.71439 WP_003254212.1.73516 WP_003254212.1.74642 WP_003254212.1.75189 WP_003254212.1.78345 WP_003254212.1.81634 WP_003254212.1.87606 WP_003254212.1.89748 WP_003254212.1.96951 gi|26990882|ref|NP_746307.1| gi|167034756|ref|YP_001669987.1| gi|397693200|ref|YP_006531080.1| gi|148546902|ref|YP_001267004.1| gi|395448197|ref|YP_006388450.1| gi|386011258|ref|YP_005929535.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]