SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167034837|ref|YP_001670068.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167034837|ref|YP_001670068.1|
Domain Number 1 Region: 184-361
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.12e-53
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.0000252
Further Details:      
 
Domain Number 2 Region: 367-472
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 1.83e-35
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.0000805
Further Details:      
 
Domain Number 3 Region: 97-202
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 4.32e-34
Family CO dehydrogenase ISP C-domain like 0.00015
Further Details:      
 
Domain Number 4 Region: 2-90
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.9e-18
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|167034837|ref|YP_001670068.1|
Sequence length 484
Comment xanthine dehydrogenase small subunit [Pseudomonas putida GB-1]
Sequence
MIQFLVNQELRSEHALDPNMTVLQYLREHLGKPGTKEGCASGDCGACTVVVGELTQDEQG
NDSLRYRSLNSCLTFVSSLHGKQLISVEGLKHQGQLHSVQQAMADCHGSQCGFCTPGFVM
SLFALQKNSSGPDLHQAQEALAGNLCRCTGYRPILDAAEQSCRQPCRDQFDAQQAQTISR
LKAITPTQTGELNSGDKRCLVPLTVADLADLYSSHPEARLLAGGTDLALEVTQFHKTLPV
MIYVGHVAELKRIEKTASHLEIGAATPLTDCYGALNDEYPDFGALLHRFASLQIRNQGTL
GGNIGNASPIGDSPPLLIALDAQVVLRQGERQRVMPLEDYFIDYRITARQDSEFIEKIIV
PRATRDWAFRAYKVSKRLDDDISAVCAAFNLSIENGVVSGVRIAFGGMAAIPKRARACEA
ALRGKPWDQAAIERACLALAEDFTPLSDFRASKEYRLLTAQNLLRKYFIEQQTPYIETRV
TAYV
Download sequence
Identical sequences B0KPX7
WP_012273426.1.54657 WP_012273426.1.65540 WP_012273426.1.66485 WP_012273426.1.81634 76869.PputGB1_3842 gi|167034837|ref|YP_001670068.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]