SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167035242|ref|YP_001670473.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167035242|ref|YP_001670473.1|
Domain Number 1 Region: 428-567
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 4.19e-35
Family Flavohemoglobin, C-terminal domain 0.0017
Further Details:      
 
Domain Number 2 Region: 327-425
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.07e-24
Family Ferredoxin reductase FAD-binding domain-like 0.0017
Further Details:      
 
Domain Number 3 Region: 554-665
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.13e-19
Family 2Fe-2S ferredoxin-related 0.018
Further Details:      
 
Domain Number 4 Region: 210-298
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.000000425
Family PNP-oxidase like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|167035242|ref|YP_001670473.1|
Sequence length 678
Comment oxidoreductase FAD-binding subunit [Pseudomonas putida GB-1]
Sequence
MQQPPDHRPSPWHAGEKTLQEKVGVAERMEAFGQKVIRDYMPDQHRTFYHQLPFMIAASV
DTLGRPWATLLEGPEGFVSSPDPRLLTIDTTLPADDPATPGLAAGEAVGLLGIELHTRRR
NRINGQIRQAAQGQLQVAVEQSFGNCPQYIQLRDYTRVDQPPQGRVDAPALDATTASMIE
GADTFFVASYVEHGNGQRSVDVSHRGGRPGFIKVEGSLLTIPDYAGNLHFNTLGNLLVNP
QAGLLFIDFSNGNVLQVCGRAEVLLDSPAIQAFEGAERLWTLQVEQVVWRPAAVSLRWAF
KAYAPTSLMTGTWAEADARLEQRRQQRQWQAWRVLRVEQESRDIRSFYLEPPAGSRVAFA
PGQHLPVQVQRDCEAALIRTYSLSSAPADGYLRISVKAQGPASRYLHERIVAGDVLNVRP
PMGSFTLDQQSTRPLVLIGAGVGITPLLAMLREQVSTGQARRIHLFHGARSLAELPFQQE
LASLQQQAAGLLRVHRALSQPEGHARVGRDFEFIGRLGIEQVKATLALDDYDFYLCGPGS
FTQALYEGLRGVHVPDARIHAEAFGPSTLRRHTDDGRPTVQQLPAANEPVPVYFAASAKE
ARWTPGSGTLLELAEARGLAPEFSCRGGSCGTCKTKLVSGQVHYPNLPAELPESGSVLIC
CAVPAHQEEGAQALVLEI
Download sequence
Identical sequences B0KTP0
gi|167035242|ref|YP_001670473.1| WP_012273813.1.65540 WP_012273813.1.81634 76869.PputGB1_4249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]