SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167035349|ref|YP_001670580.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167035349|ref|YP_001670580.1|
Domain Number 1 Region: 11-132
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.0000000000194
Family Ferredoxin reductase FAD-binding domain-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|167035349|ref|YP_001670580.1|
Sequence length 253
Comment FAD-binding 9 siderophore-interacting domain-containing protein [Pseudomonas putida GB-1]
Sequence
MSDTIHRVNHEIRQRRLQVLRVTELTPRMRRITLGGAELQGFTSVGSDDHIKLLFAETPE
QQQAIDARNLGRDGGARPTMREYTPRRIDLVTNELDIDFVLHGDGPASTWAAQAAPGQTL
SIAGPRASLVVPDIFDSYLLIGDETAIPAIGRRLEELPAGRQVLAVIQIEDEQERQPLPS
KAQVEVIWVRRQQEDLLALVRNLTLPQGRLYGWVALEKALTRQAKVLLLEKGVPEDALKA
AAYWRADGTADDE
Download sequence
Identical sequences B0KUH9
76869.PputGB1_4356 WP_012273911.1.54657 WP_012273911.1.65540 WP_012273911.1.66485 WP_012273911.1.81634 gi|167035349|ref|YP_001670580.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]