SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167035446|ref|YP_001670677.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167035446|ref|YP_001670677.1|
Domain Number 1 Region: 3-85
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 2.49e-22
Family 2Fe-2S ferredoxin-related 0.064
Further Details:      
 
Domain Number 2 Region: 187-303
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 6.55e-22
Family Aromatic dioxygenase reductase-like 0.071
Further Details:      
 
Domain Number 3 Region: 99-179
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.00000000000000197
Family Ferredoxin reductase FAD-binding domain-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|167035446|ref|YP_001670677.1|
Sequence length 306
Comment hypothetical protein PputGB1_4453 [Pseudomonas putida GB-1]
Sequence
MPEICVGEHRWAVPTGSNLLDALNEAGLNVPYSCRAGSCHACLVHCLAGQPLDALPEALA
LDKHAQGWRLACQCRVVEDLRLVLFDSRHDGVPAKVSALDWFGDVLRLRLQPERALRYQA
GQHVVLWLDEVARPYSLASLPGEDDQLEFHIDCQRPGAFCDKARGLRVGDEMRLGELRGG
ALHYDPDWQERPLWLLAAGTGLAPLWGILREALRQGHRGEIRLLHVARDRAGHYLAEPLQ
QLPGVKVELVLAEQMDDALAGLRLASRQTVALVCGAPGSVERFARRLFIAGVPRGQVFAD
VFVEHA
Download sequence
Identical sequences B0KFL9
WP_012274003.1.81634 76869.PputGB1_4453 gi|167035446|ref|YP_001670677.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]