SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167035522|ref|YP_001670753.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167035522|ref|YP_001670753.1|
Domain Number 1 Region: 7-279
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 9.1e-97
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000000306
Further Details:      
 
Domain Number 2 Region: 282-397
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 8.94e-34
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000641
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|167035522|ref|YP_001670753.1|
Sequence length 404
Comment cytochrome b/b6 domain-containing protein [Pseudomonas putida GB-1]
Sequence
MMSKFMDWIDARFPATKMWEDHLSKYYAPKNFNFLYFFGSLALLVLVNQIVTGVWLTMSF
TPSAEEAFASVEYIMRDVEYGWILRYLHSTGASAFFIVVYLHMFRGLLYGSYQKPRELVW
LFGMLIYLALMAEAFMGYLLPWGQMSYWGAQVIISLFGAIPVIGDDLTQWIRGDYLISGI
TLNRFFALHVVALPIVILGLVVLHILALHEVGSNNPDGVDIKKKKDENGIPLDGIPFHPY
YTVKDIVGVVVFLFVFCAVVFFFPEMGGYFLEKPNFEQANAFKTPEHIAPVWYFTPFYAI
LRAVPDKLMGVIAMGAAIAVLFVLPWLDRSPVRSMRYKGWISKVFLLVFCVAFVILGVLG
VLAPTPGRTLLSQVCTVLYFAYFLLMPFYTRLEKTKPVPERVTG
Download sequence
Identical sequences A0A1W2CJN7 A0A212RPR3 A0A285YJC9 A0A2J7Y7U1 A5W8R8 B0KFU5 I3USD8 I7C185
gi|397697078|ref|YP_006534961.1| 351746.Pput_4406 76869.PputGB1_4531 gi|148549610|ref|YP_001269712.1| gi|395445271|ref|YP_006385524.1| gi|167035522|ref|YP_001670753.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]