SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|167036178|ref|YP_001671409.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167036178|ref|YP_001671409.1|
Domain Number 1 Region: 87-287
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.01e-37
Family Phosphate binding protein-like 0.00056
Further Details:      
 
Domain Number 2 Region: 6-106
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.4e-21
Family LysR-like transcriptional regulators 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|167036178|ref|YP_001671409.1|
Sequence length 289
Comment LysR family transcriptional regulator [Pseudomonas putida GB-1]
Sequence
MLSSELKAFYMVARLGSITLAAKKLGLSQPTVTTQIRNLEGQYAVELFYRGGRRLVLSEE
GVRLLPMVKALLQQEADIEFELRNSGQAQGSLRIAATAPYYILDLVKIYRERLPQVEVAV
EIGNSQQVLEMLEDYRVDIAASSQLVEDARLVRRVLGTDPLVVAVHRNHPLAHRQSVSIE
GVAGHCLLMREKGSTTRKLTEQMMQEAGVKAGALLEIGSRESIREAVLRNIGISVIARHE
VPHNPELRVLALENAPVMHEYLYCLKERRQARLPAAFLGVAQEVAGSHF
Download sequence
Identical sequences B0KN93
76869.PputGB1_5191 WP_012274687.1.13892 WP_012274687.1.65540 WP_012274687.1.66485 WP_012274687.1.81634 gi|167036178|ref|YP_001671409.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]