SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167031113|ref|YP_001666344.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167031113|ref|YP_001666344.1|
Domain Number 1 Region: 25-293
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.34e-80
Family Phosphate binding protein-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|167031113|ref|YP_001666344.1|
Sequence length 307
Comment choline ABC transporter periplasmic binding protein [Pseudomonas putida GB-1]
Sequence
MHKFSAAVFALAISTATAHAADSDAQCSTVKMADPGWSDIASTNAVARLLLESLGYQVKI
DSLAVPIIYGGLKDGRVDAFLGNWMPAQQGFHDKFIANGDVQQLSRNLEGTEFTLAVPDY
VWNAGVKDFADLQKHADQFDKKLYGIGSGAPANLSLKEIIDKNEFNLGQWKLVESSEQAM
LAQVDRAVKKQQFITFLGWTPHPMNVKLKMHYLTGGEKWFGSKGEVYTLTRKGYPQACPN
AAKLLGNLKFTLDMENSIMAEVVDKKISFDDAAKAWVKTYPEVLDGWLAGVTTKADGNAL
EAVKAKL
Download sequence
Identical sequences B0KFV7
gi|167031113|ref|YP_001666344.1| WP_012269884.1.54657 WP_012269884.1.65540 WP_012269884.1.81634 76869.PputGB1_0092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]