SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167031148|ref|YP_001666379.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167031148|ref|YP_001666379.1|
Domain Number 1 Region: 20-256
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.55e-86
Family Phosphate binding protein-like 0.00000391
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|167031148|ref|YP_001666379.1|
Sequence length 256
Comment NLPA lipoprotein [Pseudomonas putida GB-1]
Sequence
MKKLLAVAAAVAAFSAHADTLTVAATPVPHAEILNFVKPQLAKEGVELKVKEFTDYIQPN
VQVAEKRLDANFFQHQPYLDEFNKAKGTNLVSVAGVHIEPLGVYSTKIKKLDELSSGATV
VIPNDATNGGRALLLLDKAGVIKLKDNKNILSTVKDVAENPKSIKFRELEAATIPRVLTQ
VDAALINTNYALEAKLNPEKDALAIEGSDSPYVNILVARPDNKDSEDMKKLAAALHSPEV
KQFIIEKYKGAVVPAF
Download sequence
Identical sequences B0KFZ2
76869.PputGB1_0127 WP_012269917.1.13892 WP_012269917.1.54657 WP_012269917.1.65540 WP_012269917.1.66485 WP_012269917.1.81634 gi|167031148|ref|YP_001666379.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]