SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167031263|ref|YP_001666494.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167031263|ref|YP_001666494.1|
Domain Number 1 Region: 28-264
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.53e-64
Family Phosphate binding protein-like 0.0000541
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|167031263|ref|YP_001666494.1|
Sequence length 266
Comment NLPA lipoprotein [Pseudomonas putida GB-1]
Sequence
MLEKLFRPVAAIAFTLGLSASALAAEPLKIGTTSAFAIPLEAAVEEAHKQGLEVKLIEFS
DWIAPNVSLNSGDIDVNYFQHIPFLENAKAAAGFNLVPYASGIINNVGLYSKTYKSFADL
PEGASVAIANDPINSGRGLQLLAKAGLITLKPGVGYKATEDDIVTNPKKLKILQVEAVQL
VRAYDDADLVQGYPAYIRLANTFDATSALLFDGLENKEYVIQFVIRPQSKDDPRLAKFVD
IYQHSPVVRAALDKAHGKLYQAGWEG
Download sequence
Identical sequences B0KH39
gi|167031263|ref|YP_001666494.1| 76869.PputGB1_0245 WP_012270028.1.13892 WP_012270028.1.54657 WP_012270028.1.65540 WP_012270028.1.66485 WP_012270028.1.81634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]