SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167031583|ref|YP_001666814.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167031583|ref|YP_001666814.1|
Domain Number 1 Region: 37-235
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.25e-25
Family Phosphate binding protein-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|167031583|ref|YP_001666814.1|
Sequence length 247
Comment hypothetical protein PputGB1_0567 [Pseudomonas putida GB-1]
Sequence
MAIRTVLLAMLLSVAPWVSAAEGVPKQIHLVSEEWLDYTNADGTGVAWDVLRKVFEPAGV
KVVTQSAPYSRAVGLVKRGEADAWVGSYKEENDDNLYPRWHFDMDHIYALGLASKPVPTP
QNVGKYRLAWVRGYDYGSYLPDVHEFREIQRREGILPMLEHDRVDFYIDAQTEVDYVLSQ
SSQPERFRRTHVAELPLYLAFARNDQAKALCDLFDKRMAELVRSGELKPIFERWKQPYPF
SADSKPH
Download sequence
Identical sequences B0KL74
76869.PputGB1_0567 WP_012270290.1.13892 WP_012270290.1.54657 WP_012270290.1.65540 WP_012270290.1.66485 WP_012270290.1.81634 gi|167031583|ref|YP_001666814.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]