SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167032092|ref|YP_001667323.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167032092|ref|YP_001667323.1|
Domain Number 1 Region: 36-275
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.93e-16
Family Phosphate binding protein-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|167032092|ref|YP_001667323.1|
Sequence length 291
Comment hypothetical protein PputGB1_1079 [Pseudomonas putida GB-1]
Sequence
MRAARCLRHLVLLCGLLPALLLQPVSAKEHIFWLVRDLPPFTIFEGPEKGQGVIDQLLPL
LIGQMPEYDHTILRVNRARGLQMLQDRNSFTCDPTLLWTPERAEYVRFSMPSLGVVSGGL
VLRKENQALMAPYLDGQQVDLHGLLSNNALKLGIVAERSYGTQIDAILRQLPDTALSRHY
GNDATANLLQMQQLGRLRLVLGYWPEVRYLIQQQGGSLADYQFHPVQGVERYQFLHVGCS
DNPLGREAIAHIDQLLPRLRQDVLPALYARWLDPALQEDYLEESKRFFEAQ
Download sequence
Identical sequences B0KRJ3
gi|167032092|ref|YP_001667323.1| WP_012270769.1.13892 WP_012270769.1.65540 WP_012270769.1.81634 76869.PputGB1_1079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]