SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167032330|ref|YP_001667561.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167032330|ref|YP_001667561.1|
Domain Number 1 Region: 35-345
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1e-46
Family Phosphate binding protein-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|167032330|ref|YP_001667561.1|
Sequence length 352
Comment extracellular solute-binding protein [Pseudomonas putida GB-1]
Sequence
MKKLFMASLLGSAIAFCTSAMAADLKALEDAARKEGTVNSVGMPDAWANWKGTWEDLASK
YGLKHSDTDMSSAQEIAKFEAEKDNASADIGDVGAAFGPIAVTKGVSQPYKPSTWDQVPE
WAKDKDGHWALAYTGTIAFIINKDLVKEGERPTSWHDLEKGKYKVAIGDVGTAAQAANGV
LAAAIAYKGDESNVAPGLQLFTKLAQQKRLSLANPTIQTLEKGEVEVGVVWDFNGLSYRE
QIDPKRFEVLIPSDGSVISGYTTVINKYAKHPNAAKLTREYIFSDAGQINLAKGHARPIR
AEHLKLPADVQAKLLPNEQYGAAQPIKNAEAWEATSKKLPQMWQEQVIIEME
Download sequence
Identical sequences B0KTT6
gi|167032330|ref|YP_001667561.1| 76869.PputGB1_1318 WP_012270999.1.13892 WP_012270999.1.54657 WP_012270999.1.65540 WP_012270999.1.66485 WP_012270999.1.81634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]