SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167033199|ref|YP_001668430.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167033199|ref|YP_001668430.1|
Domain Number 1 Region: 108-225
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 9.17e-24
Family Aromatic dioxygenase reductase-like 0.0081
Further Details:      
 
Domain Number 2 Region: 219-323
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.84e-23
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0044
Further Details:      
 
Domain Number 3 Region: 5-106
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.11e-22
Family Ferredoxin reductase FAD-binding domain-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|167033199|ref|YP_001668430.1|
Sequence length 323
Comment ferredoxin [Pseudomonas putida GB-1]
Sequence
MANTYEMFSVRVTDVEQATPLIKRFTLAREDGAAMPAFTGGSHVIVQMQGADGSQFSNAY
SLMSDPRDTRSYQIGVRLEEQSKGGSAFMHQQVEVGTRLTISSPNNLFALDPSAGRHVLI
AGGIGITPFLAQLHELEGGSTDYELHYAFRAPEHGAFQDQLANGPHAANTQFYIDSLDRK
LDLAALCAGLDAQAHLYVCGPKPLIDAVIACAAQAGIAEQRVHWEQFAATPVTGSAFTVV
LAQSGVELQVEEGMTILQAIEKSKAAKVECLCREGVCGTCETAILEGEAEHYDQYLSDEE
KAAQQSIMLCVSRARTARLVLDL
Download sequence
Identical sequences B0KMN8
gi|167033199|ref|YP_001668430.1| WP_012271843.1.13892 WP_012271843.1.65540 WP_012271843.1.66485 WP_012271843.1.81634 76869.PputGB1_2193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]