SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|167033329|ref|YP_001668560.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167033329|ref|YP_001668560.1|
Domain Number 1 Region: 1-248
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.72e-70
Family Phosphate binding protein-like 0.0000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|167033329|ref|YP_001668560.1|
Sequence length 250
Comment extracellular solute-binding protein [Pseudomonas putida GB-1]
Sequence
MNKSMALVGACALLLAGAASAETLRFATEGAYPPFNYVDADNKLHGFDIDITHALCEQMK
VECTLVAQDWEGIIPALMARKYDAVVASMIDTEERRKKIAFTDHYYRTPLTVAVAKDSKI
DSAQTDFVGYTVGAQSSSTQAIYAEDVYGKAGADVKLYPTMDEANADLAAGRLDGVIADK
FPLHEWMSKNGGDCCKILGDVADTKADAAIAVRKDDEALRQRLNTALQQIVANGTYQKIA
SKYFAFDIYN
Download sequence
Identical sequences B0KPM4
WP_012271970.1.65540 WP_012271970.1.66485 WP_012271970.1.81634 gi|167033329|ref|YP_001668560.1| 76869.PputGB1_2323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]