SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167033693|ref|YP_001668924.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167033693|ref|YP_001668924.1|
Domain Number 1 Region: 33-332
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.61e-88
Family Phosphate binding protein-like 0.0000000356
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|167033693|ref|YP_001668924.1|
Sequence length 342
Comment glycine betaine transporter periplasmic subunit [Pseudomonas putida GB-1]
Sequence
MHESKFTRSILKCATALTLVAAALGANASADKPGDGVKVTPIFPSIAEERFRGEVAMEGL
RELGYNVQEPKETEYGVMMVALANGDADFTVHLWEKLHDKFYQQAGGDDVMVKTGNILPG
VAQGYLIDKKTADQYNIKYITDLKKPEIAKLFDTDGDGKADMTGCNPGWGCELVISHHMK
AYDLDKSVNVNQGSYFALMADTIARYKEGKPILYFTWVPQWIASVLVEGKDVVWLEVPKT
DLPDGKNDVDTTYHGKNLGFAIDKVVAVLNKDFAEKNPAALKFLSLVQISTDDESNQNLK
MQQGEKKPKDIERHAKQWVAAHRQQFDQWLQASRDAAAQAGK
Download sequence
Identical sequences B0KTA1
WP_012272328.1.65540 WP_012272328.1.81634 76869.PputGB1_2691 gi|167033693|ref|YP_001668924.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]