SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167034539|ref|YP_001669770.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167034539|ref|YP_001669770.1|
Domain Number 1 Region: 26-251
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.17e-62
Family Phosphate binding protein-like 0.0000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|167034539|ref|YP_001669770.1|
Sequence length 252
Comment molybdenum ABC transporter periplasmic molybdate-binding protein [Pseudomonas putida GB-1]
Sequence
MRIRPSHLAFTALASLFAFNTAWADEVQVAVAANFTAPIQAIAKDFEKDTGHKLVAAYGA
TGQFYAQIKNGAPFEVFLAADDSTPKKLEEEKEIVPGSRFTYAIGTLALWSAKEGYVDAK
GEVLKKNAYKHLSIANPKAAPYGLAATQVLDKLKLTEATKGKIVEGQNITQAFQFVSTGN
AELGFVALSQIYKDGKVTNGSAWIVPSNLHDPIRQDAVILNKGKDNAAAKALVEYLKGPK
AAAVIKSYGYEL
Download sequence
Identical sequences B0KLQ6
WP_012273151.1.13892 WP_012273151.1.54657 WP_012273151.1.65540 WP_012273151.1.66485 WP_012273151.1.81634 76869.PputGB1_3543 gi|167034539|ref|YP_001669770.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]