SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167035543|ref|YP_001670774.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167035543|ref|YP_001670774.1|
Domain Number 1 Region: 28-256
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.17e-48
Family Phosphate binding protein-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|167035543|ref|YP_001670774.1|
Sequence length 342
Comment extracellular solute-binding protein [Pseudomonas putida GB-1]
Sequence
MKMLKTTLAVLTAAAALGAVSNAQAGATLDAVKKKGFVQCGVSDGLPGFSVPDAQGKIVG
IDADVCRAVAAAVFGDATKVKFSQLNAKERFTALQSGEVDVLSRNTTWTSSRDAGMGLVF
AGVTYYDGVGFLVNKKLGVSSAKELDGATICIQAGTTTELNVSDFFRANNLKYTPITFDT
SDESAKSLESGRCDVLTSDKSQLFAQRSKLAAPTDYVVLPETISKEPLGPVVRKGDEEWF
SIVKWTLFAMLNAEEAGITSKNVEAEAKATKNPDVARLLGGDGEYGKDLKLPKDWVVQIV
KQVGNYGEVFEKNLGQSTDLKIDRGMNALWNNGGIQYAPPVR
Download sequence
Identical sequences B0KGP3
gi|167035543|ref|YP_001670774.1| 76869.PputGB1_4552 WP_012274091.1.13892 WP_012274091.1.54657 WP_012274091.1.65540 WP_012274091.1.66485 WP_012274091.1.81634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]