SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167035993|ref|YP_001671224.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167035993|ref|YP_001671224.1|
Domain Number 1 Region: 23-243
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.05e-35
Family Phosphate binding protein-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|167035993|ref|YP_001671224.1|
Sequence length 245
Comment amino acid ABC transporter periplasmic amino acid-binding protein [Pseudomonas putida GB-1]
Sequence
MRPLLCVLGLLAMMLATPAPGHDRLRLVADNWPPFTDANMAGGGLATSIVTTALARAGYA
SGYEEVPWARALLGVGEGRYDVLINAWYNDSRANIGQFSKAYLSNRIRLLQRKGEAFHYK
HQSDLYPYSIAVVRDYAYSPEFDGDTRLHKVPVRNFSSAVRMLAAGRVNLAVEDEYVARY
NLQREPQDVRDGVMLVEPPLGENTLHILVSLKHPEHQRIVERFEQAIAAMKADGSYARLL
RQHGF
Download sequence
Identical sequences B0KL53
WP_012274515.1.65540 WP_012274515.1.81634 gi|167035993|ref|YP_001671224.1| 76869.PputGB1_5004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]