SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167036209|ref|YP_001671440.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167036209|ref|YP_001671440.1|
Domain Number 1 Region: 25-261
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.42e-84
Family Phosphate binding protein-like 0.00000726
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|167036209|ref|YP_001671440.1|
Sequence length 261
Comment NLPA lipoprotein [Pseudomonas putida GB-1]
Sequence
MKKTLLTTALAAALSFSGLAAAAEKLVVAATPVPHAEILELIKPTLAKEGVDLQIKVFTD
YVQPNVQVDQKRLDANYFQTLPYLKSFNEGKGTHLETVVGVHVEPFGGYSKKIKNLSELK
EGATVAIPNEGSNSGRALILLQKAGLITLKDPKNALATPKDIAENPKKLKFRELESAMLP
RVLDQVDLDMINTNYALEAGLNPAKDALVIEGADSPYVNFLVARPDNKDSEAIQKLAKAL
TSPEVKAFIAKKYQGAVLPAF
Download sequence
Identical sequences B0KP47
gi|167036209|ref|YP_001671440.1| 76869.PputGB1_5222 WP_012274716.1.13892 WP_012274716.1.54657 WP_012274716.1.65540 WP_012274716.1.81634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]