SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167036261|ref|YP_001671492.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167036261|ref|YP_001671492.1|
Domain Number 1 Region: 3-322
Classification Level Classification E-value
Superfamily FMN-binding split barrel 1.18e-125
Family UbiD middle domain-like 0.000000000268
Further Details:      
 
Domain Number 2 Region: 323-487
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 1.28e-66
Family UbiD C-terminal domain-like 0.0000000541
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|167036261|ref|YP_001671492.1|
Sequence length 488
Comment UbiD family decarboxylase [Pseudomonas putida GB-1]
Sequence
MQYRDLRDFIRGLEQRGELKRIQVPISPVLEMTEVCDRTLRAKGPALLFEKPTGFDIPVL
GNLFGTPERVAMGMGAESVDELREIGKLLAFLKEPEPPKGLKDAWSKLPIFKKVVSMAPK
VVKDAVCQEVVVEGDDVDLGALPIQHCWPGDVAPLITWGLTVTRGPNKDRQNLGIYRQQV
IGRNKVIMRWLSHRGGALDYREWCEKNPGQPFPVAVALGADPATILGAVTPVPDTLSEYA
FAGLLRGNRTELVKCRGSNLQVPATAEIILEGVIHPGEMAPEGPYGDHTGYYNEVDSFPV
FTVERITHRHKPIYHSTYTGRPPDEPAILGVALNEVFVPILQKQFPEITDFYLPPEGCSY
RMAVVTMKKQYPGHAKRVMLGVWSFLRQFMYTKFVIVTDDDINARDWNDVIWAITTRMDP
KRDTVMIDNTPIDYLDFASPVSGLGSKMGLDATHKWPGETTREWGRVIVKDEAVTRRIDE
LWDQLGID
Download sequence
Identical sequences B0KP99
76869.PputGB1_5274 gi|167036261|ref|YP_001671492.1| WP_012274767.1.13892 WP_012274767.1.65540 WP_012274767.1.66485 WP_012274767.1.81634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]