SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167036362|ref|YP_001671593.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167036362|ref|YP_001671593.1|
Domain Number 1 Region: 36-321
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.73e-74
Family Phosphate binding protein-like 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|167036362|ref|YP_001671593.1|
Sequence length 332
Comment phosphate binding protein [Pseudomonas putida GB-1]
Sequence
MKLKRLMAALTFAAAGVATANAVAAVDPAIPTYTKTTGVSGNLSSVGSDTLANLMTLWAE
AYKKEYPNVNIQIQAAGSSTAPPALTEGTANLGPMSRKMKDVELQAFEQKYGYKPTAIPV
AVDALAVFVHKDNPIKGLTMAQVDAIFSSTRLCGGKAEIKTWGDVGVTGDLANKPIQLFG
RNSVSGTYGYFKEEALCKGDFKPNVNEQPGSASVVQSISSSLNGIGYSGIGYKTASVKTV
ALAKKEGGEFVEDNETNALNGSYPLSRFLYVYVNKAPNKPLAPLEAEFVKLVLSQAGQQV
VVKDGYIPLPAKVVDKTLADLGLSHAGNVAKK
Download sequence
Identical sequences B0KQC8
WP_012274856.1.13892 WP_012274856.1.54657 WP_012274856.1.65540 WP_012274856.1.66485 WP_012274856.1.81634 76869.PputGB1_5376 gi|167036362|ref|YP_001671593.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]