SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167036376|ref|YP_001671607.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167036376|ref|YP_001671607.1|
Domain Number 1 Region: 27-366
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.99e-101
Family Phosphate binding protein-like 0.00000000248
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|167036376|ref|YP_001671607.1|
Sequence length 367
Comment extracellular solute-binding protein [Pseudomonas putida GB-1]
Sequence
MVRLKRLLTPFIAATLFTGALHAQAEQRTLRVYNWFDYITPQTLTDFQKDSGVKLVYDIF
DTNEALEAKLLTGNSGYDVVVPSNVFLAKQIEAGVFQPLDRSKLPNWQHLDPALMKLIEA
NDPGNKFAVPYMYGTVLIGFNPAKVKAALGDNAPVDSWDLIFKEENIAKLKQCGVALLDS
PSEIMPLALQYLGLPPNSDKPADYKKAEELMLKIRPHITYFHSSKYMADIANGDICVAVG
YSGSFSQAANRAREAKNGVVVDMRLPKEGAPIWFDMLSIPKGAANPEDAHAFINYLLRPE
VIAPISDFVGYPNPNKDATAKVNPTIRNNPNLYPTAEAMAKLYTLKPLARDAERARTRAW
TRIKSGT
Download sequence
Identical sequences B0KR67
76869.PputGB1_5390 gi|167036376|ref|YP_001671607.1| WP_012274869.1.54657 WP_012274869.1.65540 WP_012274869.1.66485 WP_012274869.1.81634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]