SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|172039752|ref|YP_001799466.1| from Corynebacterium urealyticum DSM 7109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|172039752|ref|YP_001799466.1|
Domain Number 1 Region: 44-161
Classification Level Classification E-value
Superfamily Nudix 4.76e-19
Family BT0354 N-terminal domain-like 0.0016
Further Details:      
 
Domain Number 2 Region: 166-228
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.94e-17
Family Nudix-associated domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|172039752|ref|YP_001799466.1|
Sequence length 236
Comment hypothetical protein cur_0072 [Corynebacterium urealyticum DSM 7109]
Sequence
MRRWTGLNVAERRQLGPTVAVSTVAFAIDPPHVDGASPALWVPLVRRIRPPFEGAWALPG
GPTEWNKTLTETALENLVAAAQAEPNYLEQLYAFGSVERSAEAQRTVTIAYWAQFRDSDF
QQRQRQEQENIAWFRTDDLPPLAFDHAEIIDAGIDRLRRRTEKALVAHRFLEDSFTIAEL
RHVQEVILGKKLDPANFRRQVLASGDVEETGEYQEGTKHRPAKYYRFVPESDRAEL
Download sequence
Identical sequences B1VE43
gi|448822752|ref|YP_007415915.1| 504474.cur_0072 gi|172039752|ref|YP_001799466.1| WP_012359338.1.62580 WP_012359338.1.83933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]