SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|172040011|ref|YP_001799725.1| from Corynebacterium urealyticum DSM 7109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|172040011|ref|YP_001799725.1|
Domain Number 1 Region: 3-188
Classification Level Classification E-value
Superfamily Formyltransferase 1.44e-48
Family Formyltransferase 0.0000555
Further Details:      
 
Domain Number 2 Region: 189-288
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 1.08e-16
Family Post formyltransferase domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|172040011|ref|YP_001799725.1|
Sequence length 299
Comment formyltransferase [Corynebacterium urealyticum DSM 7109]
Sequence
MSAVINAGHEVVLVVTHPASDHPYEQMWADSVEELASEHELQVCVTERVGQDVIEALRDA
APDIIVANNWRTWLPPEVFSLAKHGALNVHDGLLPEYAGFSPILWALLNRETHVGVTVHE
MDEVLDGGPIVAQRAIPVGPQDTTTDLVAKTIDLIEPLVERALSDVAQGTATAQPQDPTR
ATYFHKRGEQESRIDFTQPAEDIALLVRAQSDPYPNAYFEFRGQRVRVLSAHVSLGRFGG
TPGRVTIPHEGGIAVVCGSPRANVPAPAIVLDRVRLDDNSELTATEFFGHRAGYIQPKV
Download sequence
Identical sequences B1VEV2
504474.cur_0331 gi|172040011|ref|YP_001799725.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]