SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|172040570|ref|YP_001800284.1| from Corynebacterium urealyticum DSM 7109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|172040570|ref|YP_001800284.1|
Domain Number 1 Region: 15-278
Classification Level Classification E-value
Superfamily Cgl1923-like 1.7e-75
Family Cgl1923-like 0.000000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|172040570|ref|YP_001800284.1|
Sequence length 344
Comment hypothetical protein cur_0890 [Corynebacterium urealyticum DSM 7109]
Sequence
MPQDNSFGRRPRNAMYEMEYPVPLEADSPDEGIPMLIALQGYADAGQAIAVSGNHLLEAL
ESSVVASFNLDDLLDYRARRPSITIDENRITKSDKLSLDVRIVKDVNDRPFLLVAGPEPD
LKWEAFGHAIVELAQRANVSRAISFYSAPMTVPHTRPLVVSAHASEPSLVRDYHTWDARL
VVPGAAALETEMQLSAAGFDAIGLTAHVPHYIAGSEYPEASYALLKAFADLADRELPLKT
LEKDMSRVQQQLAQQTQDSHEIATVVGALEQQYDKEVRRLQKKKSSLLEPGQDIPTGEEL
GAEFEAFLARMNDAADTDSEADGEDPKKPGDSNDPHDDGEGDTQ
Download sequence
Identical sequences B1VDF2
WP_012360139.1.62580 WP_012360139.1.83933 gi|448823548|ref|YP_007416713.1| gi|172040570|ref|YP_001800284.1| 504474.cur_0890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]