SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|172040629|ref|YP_001800343.1| from Corynebacterium urealyticum DSM 7109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|172040629|ref|YP_001800343.1|
Domain Number 1 Region: 114-295,419-588
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.32e-99
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000885
Further Details:      
 
Domain Number 2 Region: 292-414
Classification Level Classification E-value
Superfamily GAD domain-like 5.4e-35
Family GAD domain 0.00047
Further Details:      
 
Domain Number 3 Region: 2-104
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.67e-28
Family Anticodon-binding domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|172040629|ref|YP_001800343.1|
Sequence length 606
Comment aspartyl-tRNA synthetase [Corynebacterium urealyticum DSM 7109]
Sequence
MLRTHLAGELRPGDIDSEVTLTGWVGRRRDHGGVIFIDLRDRSGVAQVVFRESEVAERAH
ALRSEYCVRVRGRVEARPEGSENPNLPSGAVEVNVSELEVLNESAALPFQIDDPSSAGEV
GEETRLKYRYLDLRRASQGDALRLRSKANAAARKVLERHDFTEIETPTLTRSTPEGARDF
LVPARLKPGTFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDVEM
SFVDQEDVIALAEEILTEVWSTAGYEVQTPFPRMTYADAMRLYGSDKPDLRFDIQITECT
EFFKDTTFRVFQNEYVGAVVMDGGASQPRRQLDAWQEWAKQRGAKGLAYILVGEDGELSG
PVAKNITDDERAGIADHVGAKPGDCIFFAAGDTKSSRALLGAARGEIAQKLGLIDDSKWA
FTWVVDAPMFEPAADARAEGDVALGNSAWTAVHHAFTSPKPEFLDSFDQDPGSALAYAYD
IVCNGNEIGGGSIRIHQRDVQERVFQVMGISQEEAREKFGFLLDAFAFGAPPHGGIAFGW
DRIVSLLGGFDSIRDVIAFPKSGGGVDPLTDAPSEITPEQRKESGIDAKPKRAAAAQAGA
AKASSK
Download sequence
Identical sequences B1VDL1
gi|448823605|ref|YP_007416770.1| WP_012360197.1.62580 WP_012360197.1.83933 504474.cur_0949 gi|172040629|ref|YP_001800343.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]