SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|172041543|ref|YP_001801257.1| from Corynebacterium urealyticum DSM 7109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|172041543|ref|YP_001801257.1|
Domain Number 1 Region: 74-220
Classification Level Classification E-value
Superfamily Nudix 1.4e-25
Family MutT-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|172041543|ref|YP_001801257.1|
Sequence length 270
Comment NUDIX domain-containing protein [Corynebacterium urealyticum DSM 7109]
Sequence
MPYPFEDWRAAIATQPPLAADLPEWLTRLATAARSGSVHEALNDPARHVPETNEDGVPPR
YSAVLILLGGDPDYRPTAIHPFPEDATVVLTHRGVDMRNHSGQMAFPGGAWEPQDATPID
TAVREAVEETGLNPEGVEPVAVMDPVYIDRTNFAVVPVIAYWREFSPVHPATVENDWVQP
VAIRELVHPDYRFKLGFAGWSGPAFDVSGMVLWGFTAGVLDALLRLAGWHEDWDEETQFD
LFRTLEQSRNGESRALRAHFVAEGKKDTGE
Download sequence
Identical sequences B1VI23
504474.cur_1864 WP_012361098.1.62580 gi|172041543|ref|YP_001801257.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]