SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171056734|ref|YP_001789083.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171056734|ref|YP_001789083.1|
Domain Number 1 Region: 3-94
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 1.45e-19
Family PhoB-like 0.0019
Further Details:      
 
Domain Number 2 Region: 302-408
Classification Level Classification E-value
Superfamily TPR-like 0.000000000304
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 
Domain Number 3 Region: 419-509
Classification Level Classification E-value
Superfamily TPR-like 0.00000211
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|171056734|ref|YP_001789083.1|
Sequence length 543
Comment transcriptional regulator domain-containing protein [Leptothrix cholodnii SP-6]
Sequence
MSHRYTTGEFEVRPDERRVLLRGEPVPLGARAFDVLMCLIAQRERVVTKNELLEQVWPGM
VVEENNLTVHVSALRKVFGAQAVATIPGRGYRFVMALDETTGAPAVAPVPAPAPASVVGA
DGPTGLTLPDRPSIAVLPLDNLSGDAQQDLLIEGLSEDVITELSRFRSLFVIARNSSFSF
RGLAHGERDVRAIARELGVRYVLEGSLRRAGDRVRVAVQLVDAVSATQLWAEKYDRAVDD
LFALQEELTRAIVGAIAPQIEAGEFQKIRSARGRDLNAYTLAMRARDTARRADREGDATT
RDEALRLAHEAVEIDPGCGVALATIAFVQWQQIWAGSAASPVDAAVAGLAAARRAIALDG
SDHHAHLWKAMLQLFTHQHAAGLADLQRAHELNPNDALTLSLLGQYLAAEADSAADAATG
VRHVLDALRLSPRDPLRWSFLNSLAWASFAAFDHAGAVDAASRALGEAPQFPPARLCRVI
GQVGLGAIDAARADFETLRALAPQMVATRLAGDWSYANPALVQRATAFLRVAAGLDEPGR
LDT
Download sequence
Identical sequences B1Y588
395495.Lcho_0043 gi|171056734|ref|YP_001789083.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]