SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171056864|ref|YP_001789213.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171056864|ref|YP_001789213.1|
Domain Number 1 Region: 4-282
Classification Level Classification E-value
Superfamily Folate-binding domain 8.32e-73
Family Aminomethyltransferase folate-binding domain 0.0000461
Further Details:      
 
Domain Number 2 Region: 289-371
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.000000000000147
Family Aminomethyltransferase beta-barrel domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171056864|ref|YP_001789213.1|
Sequence length 376
Comment glycine cleavage T protein (aminomethyl transferase) [Leptothrix cholodnii SP-6]
Sequence
MTSWRISALADRHRALGSTLADWNGMGTAWTYSSDLADEHEAIRTHAGLMDVSGLKKVHV
IGPHAEALINQAVTRNVSKLYPGKSVYACMLNEAGKFIDDCVIYRNGPNAFMVVHGAGQG
HEILTRGAVGRNVAVLFDDDLHDLSLQGPLAVEYLSRHVPGIRQLPYFHHLQTTLFGRPV
MISRTGYTGERGYELFCKAADAPTIWDTIVAEGKAMGIVPCAFTALDWLRVESCLLFYPY
DNSDMYPMDGEPIGDTLWELGLDFTVSPGKTEFRGAAEHFRLQGRERFKIFGIELDSTEA
AQAGDALYDGDTKVGFVTCGMYSRLSGRSMAIARMDTAYAVPGRKLALRGAALNCAASTH
SLPFDDPQKTKRMAKD
Download sequence
Identical sequences B1Y6X0
gi|171056864|ref|YP_001789213.1| 395495.Lcho_0173 WP_012345210.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]