SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171057040|ref|YP_001789389.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171057040|ref|YP_001789389.1|
Domain Number 1 Region: 71-119
Classification Level Classification E-value
Superfamily LysM domain 0.00000131
Family LysM domain 0.0094
Further Details:      
 
Weak hits

Sequence:  gi|171057040|ref|YP_001789389.1|
Domain Number - Region: 135-193
Classification Level Classification E-value
Superfamily Tryptophan synthase beta subunit-like PLP-dependent enzymes 0.0672
Family Tryptophan synthase beta subunit-like PLP-dependent enzymes 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|171057040|ref|YP_001789389.1|
Sequence length 394
Comment peptidoglycan-binding LysM [Leptothrix cholodnii SP-6]
Sequence
MILRHPPIVRSQPLSALLGGLLGLALCSVALDSQAQAFPDYPITAGQRSTARQVAQAGVP
LSELAPDAPDSYTVKRGDTLWDISQIFLRSPWRWPELWGMNLEQIRNPHLIYPGQLLVLV
KSNGRARLEMGRAVEGGTQKLSPRARAAGIDRGPIGPIAMHLIQPFLNDAVVLDSNELES
APRIVAGREGRVLLGRGDIAYVRGDLPPRRDWQVFRQAKPLHDPASGEVLGYEAAFVGSA
EYIQPGRTQPGAENTTELVPATFNLVSLRQEAGVGDRLAAAPPRDDSLYVPHSPAAPLEA
LVVSIYGDGLHAGQNQIVSVNRGKSTGMEPGHVLAIWRTGSLVRDAEDPQRQALRLPDER
NGNLFIFRVFNRVSYGLILSSETPVRAGDRITQP
Download sequence
Identical sequences B1XW97
gi|171057040|ref|YP_001789389.1| 395495.Lcho_0349 WP_012345386.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]