SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171057048|ref|YP_001789397.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171057048|ref|YP_001789397.1|
Domain Number 1 Region: 15-96
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.22e-18
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|171057048|ref|YP_001789397.1|
Sequence length 101
Comment DNA polymerase subunit beta [Leptothrix cholodnii SP-6]
Sequence
MTVPALISLSAGDLAPICRRHGIHRLAVFGSRLKGTARADSDLDLLVEFEPGRVPGLLGL
SAIEIELTEALGVKVDLRTAQDLSPYFRDEVLRQAQVAYAG
Download sequence
Identical sequences B1XWA5
gi|171057048|ref|YP_001789397.1| 395495.Lcho_0357 WP_012345394.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]