SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|171057145|ref|YP_001789494.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171057145|ref|YP_001789494.1|
Domain Number 1 Region: 72-323
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.73e-54
Family L-arabinose binding protein-like 0.00015
Further Details:      
 
Domain Number 2 Region: 2-50
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000271
Family GalR/LacI-like bacterial regulator 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|171057145|ref|YP_001789494.1|
Sequence length 339
Comment LacI family transcriptional regulator [Leptothrix cholodnii SP-6]
Sequence
MRVTIREVALAAGVSIGTVSRALKNQRGLSDETRRHVRAVARQLGYDSDRLRSGKAQRLV
FLVHRHHSSFALNPFFSLVMHGVEEACREFGIAPTLLAAGPADPVRDLLRLHEPDALLAA
GYFEAELLTLLKGLELPMALVDFWMPGCASVNPDNRMGGYLATRHLLDLGRRRIAYLAGS
LAHFSSRERELGYRRALFEAGVLADPDLEVIAPPGLDVASGAEAAMRVLLRLHPRPDALF
AYNDTAALAALEVCQEAGLRVPQDIAIVGFDDIPAAGYAPTPLTTLRVDKAALGRTGVEL
IMRGAEMPQETTLPVTLIVRASSRIDSSSAVEAATAAID
Download sequence
Identical sequences B1XXW0
WP_012345491.1.27902 395495.Lcho_0454 gi|171057145|ref|YP_001789494.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]