SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171057340|ref|YP_001789689.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171057340|ref|YP_001789689.1|
Domain Number 1 Region: 487-598,850-901
Classification Level Classification E-value
Superfamily Cupredoxins 3.1e-20
Family Multidomain cupredoxins 0.0057
Further Details:      
 
Domain Number 2 Region: 278-369,422-447
Classification Level Classification E-value
Superfamily Cupredoxins 0.00000000000479
Family Multidomain cupredoxins 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171057340|ref|YP_001789689.1|
Sequence length 945
Comment multicopper oxidase type 2 [Leptothrix cholodnii SP-6]
Sequence
MRRGAYILGALGAVSLSVAVTAQVVGEVDIFGDPPPNDPSALIEPAIGDQANEDLKLLEH
SNHSSYEGTPNGEKADVYVEAAIQPLQQTSEKIPTGGKPSPDFGAKRYTTPLLMFEEFGP
EKLDPSVQAGTNPLPRPKIGPLPAQDPRSAARSAPDGTELEAFLAQPGMYPFPTHQSNTL
DANPWRDDVAEFLGRSVNSPAEGRPPGEGWAHQRWNEMYPQAFFKTAQAGSRVNNGFRDQ
KQLHKYKVGEFGPGGLYHKPFLTSKANGTTAGIDVRFHQNFPVQHQNSVWTFDGTMPPKL
LMVRYGEPILMRHYNALPIDPAANKGFGLHTISTHMHNGHNPAESDGVAQAFFFPGQFYD
YRWPIQLAGYDTVNTGATDPRAGFPCSPGETLFVNDASPGKKACPANGVIKIRGDWRETM
STQWFHDHMLDFTAQNVYKGNAVMMNYYSAIDRGNEKIDCHYTDPNANDPSKVPTKVNLC
LPSGSGMPWGNRDYDINLVIADKAWGRDGQLWFNVFNKDGFLGDRILTNFVYHPYLDVRA
RRYRFRILPGSVSRYFALALVHERTDTKGEIKATVGGKKISYDRVPFHMVANDGNILEHA
VPFDGTVDLDANGDKLEHKGTLPQMAIAERYDIVVDFKKFKAGDKLYFVNTQEHADPVKT
NRRIPVADVLTGKYKPAVLEDKDGDGVADRWTDGDPGVGKFMELRIQSCKNAAGKAVACV
DTSMNPADYVAGKKKMVPLKLNRDDPVHHAKLQNATHREFKFGHSGGTDEQPWTIKTDGG
PGYNADMRRITAAPQLSTGPTAGGSVQNESPYEVWYLELQGSWDHPVHVHFEEGIILRRD
GKAPPEWEKWARKDIYRIGPDPHAGSSVEVALQFREFAGTFVEHCHATQHEDNAMLMRWD
LERPGQTLAMPTPMPTWDGVHYTGSAALATFKSGAGTGTTYQLGQ
Download sequence
Identical sequences B1XZS8
WP_012345686.1.27902 gi|171057340|ref|YP_001789689.1| 395495.Lcho_0649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]