SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171057563|ref|YP_001789912.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171057563|ref|YP_001789912.1|
Domain Number 1 Region: 138-215
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.0000000000000986
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.012
Further Details:      
 
Domain Number 2 Region: 31-140
Classification Level Classification E-value
Superfamily Pheromone-binding domain of LuxR-like quorum-sensing transcription factors 0.0000085
Family Pheromone-binding domain of LuxR-like quorum-sensing transcription factors 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171057563|ref|YP_001789912.1|
Sequence length 254
Comment LuxR family transcriptional regulator [Leptothrix cholodnii SP-6]
Sequence
MQACIGLLDADQAYFVTFVRDDHDLVICRFMLACDARWCRRYLAAGCQNHDPWLVYATHH
SEPTAASALDVVATEHRQVVALIHEGGFVSTLLVPAHSGLSQARTSLLCLGSETVDHFER
RDSAGHRILARALAAELHEWWSARIRRELVEAAQLTPTELSLVRHQCAGHSSKRIASELH
VSPASIDSRFQRLHAKLGVLNRRQAARLLVDCGLILPSFNSRRALGPMQIEPINTGVSTG
SSSGASRAPPPVER
Download sequence
Identical sequences B1Y1W7
gi|171057563|ref|YP_001789912.1| 395495.Lcho_0875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]