SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171057603|ref|YP_001789952.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171057603|ref|YP_001789952.1|
Domain Number 1 Region: 310-499
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.2e-43
Family Histidine kinase 0.0026
Further Details:      
 
Domain Number 2 Region: 534-659
Classification Level Classification E-value
Superfamily CheY-like 3.56e-38
Family CheY-related 0.0023
Further Details:      
 
Domain Number 3 Region: 239-322
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 2.75e-21
Family Homodimeric domain of signal transducing histidine kinase 0.0018
Further Details:      
 
Domain Number 4 Region: 710-814
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 0.00000000000000288
Family Phosphorelay protein-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|171057603|ref|YP_001789952.1|
Sequence length 822
Comment Hpt sensor hybrid histidine kinase [Leptothrix cholodnii SP-6]
Sequence
MKPAVVDSPSADLPLSSTPSGVGRTAGLGRWLSLLALVLLGVFAGVGWVQWQSISLLNAT
VQYQGDNLVWSFYQLESEYEKVRLAARELDHETTPEAVAALQARYEVFVSRISLVEPERT
ESLSVLLPAQRDVIARVHAFVERTDQLIGPDATPPMDPGFWRQFADGMAPLSVEIHELAL
QANRDIADQVALRNEAVRRQNGIAIGLTIFQSLLTLLFAVVVVRQVRALQQRRTHLEALA
ANLQEARIEAEQASRAKSAFLANMSHELRTPFNGLLGMLSLLQRSPLDARQADYLQTARE
SGEHLLAILNDVLDISKLESGRLEITPERTSLIRVLGDVRSVMSPQAQAKHLRWSVTVAD
DVPVWIRADAKRLKQVLFNLVGNALKFTENGEVSVHVDCVPAPATASAAPGAAEAVPAAT
AWLRFAVTDTGIGMDALTLARLFQRFSQGDETINRRFGGTGLGLEISRTLARRMGGDITV
RSEAGRGSVFTVLLPFERIDAPPAEDTAPVVRPVPGGVTPAADGQSADPAGGAPLRVLVT
DDHPVNRKFMQALLQQLGHQVHLRENGAEALEALHEHTFDLILMDVHMPVMDGLAATRAI
RALDGAAAQVKIVALTADAFSESRQRVIDAGMDDFLAKPVQMQDVEEMLRRNFGARAVFE
PAVPPADWAPPPEPAVVVAPSQPAVATLAPEVSAPPAPRRRFKRGDASRVLDLEAIGEVC
LAVSMVGYGSLLSGFLADESRTIAELIEVLESHDVARFKAAAHKLKGAAANLGLRLLSAT
AREIEQAEAEPDEARSRDYALRLAEELDLTRALCTRLGLLAG
Download sequence
Identical sequences B1Y2H1
395495.Lcho_0915 gi|171057603|ref|YP_001789952.1| WP_012345949.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]