SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171057619|ref|YP_001789968.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171057619|ref|YP_001789968.1|
Domain Number 1 Region: 20-293
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 5.65e-98
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000000225
Further Details:      
 
Domain Number 2 Region: 359-453
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 2.22e-18
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.001
Further Details:      
 
Domain Number 3 Region: 294-332
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.00000000105
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|171057619|ref|YP_001789968.1|
Sequence length 467
Comment cytochrome b/b6 domain-containing protein [Leptothrix cholodnii SP-6]
Sequence
MAEFKEAPADATAAVKLMTWVDNRFPATKLYKEHLSEYYAPKNFNFWYFFGSLALLVLVI
QIVTGIFLVMHYKPDANLAFASVEYIMRDVPWGWLIRYMHSTGASAFFVVVYLHMFRGMI
YGSYRKPRELVWVFGCLIFLCLMAEAFMGYLLPWGQMSYWGAQVIVNLFAAVPFVGEDLA
LLIRGDFVVGDATLNRFFSFHVIAVPLVLLGLVVAHIIALHEVGSNNPDGVEIKAKKDPK
TGHPLDGIPFHPYYSVHDLVGVTVFLMVFTAVVFFAPEFGGYFLEYNNFIPADPFKTPAH
IAPVWYFTPFYSMLRATTDTMINVLSVIIAAAAVLGVLKGGLSGKGKLIALVGAVVAIGL
LKIFDAKFWGVVVMGGAVIILFFLPWLDKSPVKSIRYRPTWNLYLYAVFVVFFLVLGYLG
IQPPSDIGTLVAQVGTLFYFGFFLLMPWWTQLGTFKPVPDRVTFAAH
Download sequence
Identical sequences B1Y2I7
WP_012345965.1.27902 gi|171057619|ref|YP_001789968.1| 395495.Lcho_0931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]