SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171057735|ref|YP_001790084.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171057735|ref|YP_001790084.1|
Domain Number 1 Region: 26-436
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5e-133
Family Tandem AAA-ATPase domain 0.000000000488
Further Details:      
 
Domain Number 2 Region: 59-104,480-600
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.89e-36
Family Tandem AAA-ATPase domain 0.00000156
Further Details:      
 
Domain Number 3 Region: 637-685
Classification Level Classification E-value
Superfamily C-terminal UvrC-binding domain of UvrB 0.000000000000379
Family C-terminal UvrC-binding domain of UvrB 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|171057735|ref|YP_001790084.1|
Sequence length 703
Comment excinuclease ABC subunit B [Leptothrix cholodnii SP-6]
Sequence
MGELQEAVIEPAAATAGQFVSYEGSPFQLFQPYPPAGDQPTAIEGLVSGIQDGLTYQTLL
GVTGSGKTFTMANVIARMGRPAIIFAPNKTLAAQLYAEFREFFPKNAVEYFVSYYDYYQP
EAYMPQRDLFIEKDSSINEHIEQMRLSATKSVLERRDTIIVATVSAIYGIGKPEDYTQMR
FIVRVGDTIGQRDVIAQLIRMQYTRNDTEFARGTFRVRGDTIDIFPAEHSELAIRLELFD
DEVESLQLFDPLTGRVRQKVPRFTVYPSSHYVTPRERVLAAIEGIKLELRERLAEFVADG
KLVEAQRVEQRTRFDLEMLQEVGHCKGIENYSRHLSGAAPGEPPSTLVDYLPSDALMFLD
ESHVLIGQLGGMYNGDRARKTTLVAYGFRLPSAMDNRPLRFEEFERKMRQVVFVSATPAD
YEKQHAGQVVEQLVRPTGLVDPLIEVRPAGSQVDDVLQEIRLRVAINERVLITTLTKRMA
EQLTDYMAENGVKVRYLHSDIDTVERVEILRDLRLGTFDVLVGINLLREGLDIPEVSLVA
ILDADKEGFLRAERSLIQTIGRAARNVNGKAILYADKMTESMRKAIGETERRRARQVEHN
TLHGITPRGIRKHVKELIDGVYGEKSGKDDLAIMHSVAEVEALSEKDLGKRIKQLEKQML
EHARNLEFEKAARIRDQLAQLREQAFGAAGSDNIDALVAKGGS
Download sequence
Identical sequences B1Y3B6
WP_012346081.1.27902 395495.Lcho_1050 gi|171057735|ref|YP_001790084.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]