SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171057767|ref|YP_001790116.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171057767|ref|YP_001790116.1|
Domain Number 1 Region: 814-977
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.81e-43
Family Histidine kinase 0.0044
Further Details:      
 
Domain Number 2 Region: 1002-1128
Classification Level Classification E-value
Superfamily CheY-like 8.4e-26
Family CheY-related 0.021
Further Details:      
 
Domain Number 3 Region: 744-824
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.16e-19
Family Homodimeric domain of signal transducing histidine kinase 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|171057767|ref|YP_001790116.1|
Sequence length 1220
Comment histidine kinase [Leptothrix cholodnii SP-6]
Sequence
MSASNPSMSLPLPAAPDSNAAPEPLSPEAPAAPQRVIKVRRDYNSWVASETKEDYALRFA
PRSFRRWSEWRVANTALGGASSFLVLEAVGATLLVQYGFVNAAWAILATGLVIFLAGLPI
SYYAARYGLDMDLLTRGAGFGYIGSTLTSLIYASFTFIFFALEAAVMAYALELAFDIPPA
WGYLACALVVIPLVTHGVTLISRLQVWSQPLWLVMLVLPYVYVFDRNPGVLDELVTYGGE
HGITGFDGLAFGAAMTVGIALITQMGEQADYLRFMPERRPGRRGSWWLGTLVGGSGWVIP
GVLKMLGGALLAYLAISHMVPLDRAVDPNQMYLAAYEYVFPNYGWAVAATALFVVVSQLK
INVTNAYAGSLAWSNFFSRLAHSHPGRVVWMLFNILIALVLMELDVFQALGGVLGLYSNL
AISWIMAVVADLVINKPLGLSPKGIEFRRAYLYDINPVGVGAMVAASLLSVAAYLGLFGA
MAQAWSALIALVTAFIASPLIAWATRGRYYLARTPEVPVGQGCAGVVIPIRPVVEGPGRY
VRLGQGPSADGALQLAVCCICEREYECDDMAGCPAYGGPICSLCCTLDARCNDLCKPHAR
LSVQWSAALQRLLPSRVWPYLDKGLGHFVLLMLVVTPLMALMFGVLFHQELRSLAARGLQ
EDAFLWPVLAEGLKSGFIKAYATLLLTAGVVAWWLVLAHKSRLVAQEESNRQTQALNEQA
QALNEQALALKREIESHRQTDLQLQEAKRVADAANQAKSRYITSISHELRTPLNSILGYA
QLLEEDDAMPAHRKQAVSVIRRGGDHLLSLIEGTLDLARIESGKLALAIKPMRFADALHE
MAHLFALQAAAKGIGFRSEFDPHLPEAVRADEKRLRQILINLLGNAVKFTVSGDVILRVQ
YAREIARVEIIDSGPGMDAAELERVFEPFVRGSSAGATAGGGTGLGLTISRMLCDLMGGE
MTVESTPGVGSTFRLKLFLPAVHGSRAEHKISPPNRSGYEGPRRRILVVDNEEADRGLLL
SVLEPLGFELLQAASGEDCLALLQGLPEATRPDAIFMDLAMPGIDGWETLRRIRALGLSE
AGAAIVSANAFDQALENDVGITPADFFVKPVRVPDLLDWLGQRLRLAWIEGARAPVPPSA
PSGPPGAAAWVLPPAALLRELDELATLGYQRGILRKLDEIERGHADCRGFVDHLRQLARQ
FQLDTLAALLRRALDEQPHA
Download sequence
Identical sequences B1Y3V7
395495.Lcho_1082 WP_012346113.1.27902 gi|171057767|ref|YP_001790116.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]