SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171057768|ref|YP_001790117.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171057768|ref|YP_001790117.1|
Domain Number 1 Region: 10-133
Classification Level Classification E-value
Superfamily CheY-like 1.42e-38
Family CheY-related 0.00077
Further Details:      
 
Domain Number 2 Region: 246-308
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 3.23e-18
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|171057768|ref|YP_001790117.1|
Sequence length 316
Comment two component LuxR family transcriptional regulator [Leptothrix cholodnii SP-6]
Sequence
MLDRNNNDLVLIVDDVPDNLAVLHDALDESGYTVLVATNGADAIARASQAQPHIVLLDAV
MPGMDGFEVARRLKALPATAHIPIVFMTGLTETEHVLAAFAAGGCDYVTKPIRAREVLAR
IAAHMHTAREQQLARNALDAFGHASLVVRLIDGRILWQTALARQLLAPADAEPGWESRRA
PTPVLAWLQRETTRLAAQPVPSNAQAASVELDVGGRQLRCTLQESTGDGEWLVVLRQADD
AATLEALVLAFRLTPREAEVLYWLAKGKTNRDIGEILGSSAATVKKHLEHVYEKLGVETR
NAAAAVAIGKVAQLGR
Download sequence
Identical sequences B1Y3V8
WP_012346114.1.27902 gi|171057768|ref|YP_001790117.1| 395495.Lcho_1083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]