SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171057792|ref|YP_001790141.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171057792|ref|YP_001790141.1|
Domain Number 1 Region: 316-493
Classification Level Classification E-value
Superfamily DNA-glycosylase 4.01e-45
Family DNA repair glycosylase, 2 C-terminal domains 0.0000939
Further Details:      
 
Domain Number 2 Region: 17-91
Classification Level Classification E-value
Superfamily Ada DNA repair protein, N-terminal domain (N-Ada 10) 8.24e-31
Family Ada DNA repair protein, N-terminal domain (N-Ada 10) 0.00048
Further Details:      
 
Domain Number 3 Region: 212-311
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.05e-24
Family DNA repair glycosylase, N-terminal domain 0.0006
Further Details:      
 
Domain Number 4 Region: 152-200
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000026
Family AraC type transcriptional activator 0.019
Further Details:      
 
Weak hits

Sequence:  gi|171057792|ref|YP_001790141.1|
Domain Number - Region: 102-148
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000582
Family AraC type transcriptional activator 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|171057792|ref|YP_001790141.1|
Sequence length 502
Comment AraC family transcriptional regulator [Leptothrix cholodnii SP-6]
Sequence
MIVCMPSRSAPLASTDATAHAACYAALVARDRRFDGRFFVGVTSTGIYCRPVCGVRTPKA
ANCRFFDNAAAAEAGGFRPCLRCRPELAPGLAGIDMPSRLAWAAAQRIEAGALDDGGLTG
LSARLGITDRHLRRIFMAAFGVTPIDYAQTQRLLIAKRLLADTTLPVTEVALAAGFGSLR
RFNHLFQSRYRLTPGELRRASGPAAREGGLHFELAFRPPLDWPRLLAFLAARCVAGVEAV
ADGTYRRSVRLHAGGSEHTGWLALGLAAHGEAIAVDVAPSLLRVLPALLAGVRRLCDLSC
DPQAVAAVLGPLAADAPGLRVPGAFDGFEMAVRAVLGQQVTVKAAHTLAGRMAAAFGEPL
RSEQSLDGVGLLFPTPQRLASAGAEQIAALGIVRSRADALIALAQAVSSGEIDLGPAADV
ALCTERLQALPGIGRWTAQYIALRALGWPDAWPSGDVALIKALGAAGPREADALAEAWRP
WRSYATVQLWRRLAEAATAPKP
Download sequence
Identical sequences B1Y3Y2
395495.Lcho_1107 gi|171057792|ref|YP_001790141.1| WP_012346138.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]