SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171057848|ref|YP_001790197.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171057848|ref|YP_001790197.1|
Domain Number 1 Region: 25-276
Classification Level Classification E-value
Superfamily Hsp33 domain 1.57e-56
Family Hsp33 domain 0.00000497
Further Details:      
 
Domain Number 2 Region: 269-326
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 1.96e-17
Family HSP33 redox switch-like 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|171057848|ref|YP_001790197.1|
Sequence length 339
Comment Hsp33 protein [Leptothrix cholodnii SP-6]
Sequence
MARSSDPKDPIHPQLDSTRFAGGELHKFIFEGLPVRGMIVRLTGAWTEMLQRRQSAGGYP
EPVQRLLGEMCAAATLMQANIKFNGALILQMQGDGPVKLAVAEAQPDLALRATASVIGEV
PEGADIAALLNVNGQGRCAITLDPKDRHAGQQPYQGVVPLHGDQKEPLTQLSEVLEHYML
QSEQLDTRLVLAANGQVAAGLLIQRLPVQGEGNLGGRRNEDDIGLDEHYNRIAILAGTLK
QEELLTLDVDTLLRRLFWEEDLRRFEPQAPRFACTCSRERVGRMLVSLGRAEVDSVAIER
GQVEVGCEFCGLQYRYDPVDVAELFSPVLAQAGGTHTVQ
Download sequence
Identical sequences B1Y4J3
WP_012346194.1.27902 gi|171057848|ref|YP_001790197.1| 395495.Lcho_1163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]