SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171057951|ref|YP_001790300.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171057951|ref|YP_001790300.1|
Domain Number 1 Region: 62-197
Classification Level Classification E-value
Superfamily Cupredoxins 1.31e-38
Family Multidomain cupredoxins 0.0013
Further Details:      
 
Domain Number 2 Region: 174-331
Classification Level Classification E-value
Superfamily Cupredoxins 6.48e-32
Family Multidomain cupredoxins 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|171057951|ref|YP_001790300.1|
Sequence length 470
Comment multicopper oxidase type 3 [Leptothrix cholodnii SP-6]
Sequence
MVSRRNFLGRAGAVTAAVSAAAVSRVAMAALPEPVIQTKPDTMPPLVPASGRPYNPVVTL
NGWTLPWRMNNGVKEFHLVAEPVVREMAPGMRAHLWGYNGQSPGPTIEVVEGDRVRLFVT
NKLPEHTSVHWHGQRLPNGMDGVSGLTQPSIQPGKTFVYEFVARRPGTFMYHPHADEMTQ
MAMGMMGFWVTHPKEKHPLIDEVNRDFCFLLNAYDIEPGAATPKIMTMTEFNLWSWNSRI
FPGIDSLNVRLNDKVRIRVGNLTMTNHPIHLHGHEFQVTGTDGGPTPKSTRWHEVTTDIG
VGQMRQIEFVADEEGDWAFHCHKSHHTMNAMGHDVPTLIGVDHSGLAKKITDLIPDYMVM
GERGMADMAEMEMPLPDNTVPMMTGEGPYGSVEMGGMFSVLKVRRDQKPGDYGNPGWYKP
PAGTVAFEWTGSLPDPARFAAEGGQSMPLAHKPAKEIEVRARKPSGHSGH
Download sequence
Identical sequences B1Y5E7
395495.Lcho_1266 WP_012346297.1.27902 gi|171057951|ref|YP_001790300.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]