SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171058085|ref|YP_001790434.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171058085|ref|YP_001790434.1|
Domain Number 1 Region: 6-147
Classification Level Classification E-value
Superfamily CheY-like 5.83e-30
Family CheY-related 0.0037
Further Details:      
 
Domain Number 2 Region: 235-363
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.7e-19
Family Histidine kinase 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|171058085|ref|YP_001790434.1|
Sequence length 384
Comment response regulator receiver sensor signal transduction histidine kinase [Leptothrix cholodnii SP-6]
Sequence
MPTADKANILLVDDEPENLSALRVLLDGADRHLLLAHDADAALRCASEHDLALILLDVCM
PGTDGFESAQMLRRNERSRLAPIIFLATSADDLASISRGYEVGAVDYLVKPLLPEVLRSK
VSVFVDLHRKNTELRHEVAVRRSAERQVRESEARLHALTSHFITMREKERTAIAREIHDE
LGQVLTVLKMDIAWLARHPDDARLRVKTDAMSRLIDDTIRSVRKISAGLRPEVLDDMGLV
SAIAWQTTEFQKRTGVRCRSALPPETEVFDKDLSNTLFRIFQEILTNVARHAHATRLDVE
LRQAGDRLVLKVADNGVGIVVQEANAPTTLGLLGMHERALRLGGTVAIDGEPGAGTRVRV
SIPIPGSQREHGRESRSERAEGLP
Download sequence
Identical sequences B1Y742
gi|171058085|ref|YP_001790434.1| WP_012346431.1.27902 395495.Lcho_1401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]