SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171058147|ref|YP_001790496.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171058147|ref|YP_001790496.1|
Domain Number 1 Region: 6-151
Classification Level Classification E-value
Superfamily CheY-like 1.12e-37
Family CheY-related 0.00054
Further Details:      
 
Domain Number 2 Region: 149-351
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.77e-35
Family HD domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|171058147|ref|YP_001790496.1|
Sequence length 364
Comment response regulator receiver modulated metal dependent phosphohydrolase [Leptothrix cholodnii SP-6]
Sequence
MTADTRATVLIVDDDVDNLFVLTELLRPHYRVLAATSGPACLRMANGAPRPDLILLDVMM
PGLDGYAVLARLRENPCTHDVPVVFLTALSDPSDEDRGLRLGANDYITKPLKPAIVLARV
RTQLEAKQARDWMTDRNAALEAEVARRMAENDLTQRVTIRALAHLAETRDPETGNHILRT
QGYVRRLALALRDNPRFAVTRSDRYVDLLTMSAPLHDIGKVAVPDHILLKPGKLTADEWV
IMKTHAKRGSDAIEQAEHDVEAPLEFLAVAKEIAHWHHEKWDGSGYPDGLAGDAIPVSAR
LMAVADVFDALISTRPYKKPLSIAEAHDVIVDGRGRHFDPDVVDAFVACLDDFAAIADRS
RDGE
Download sequence
Identical sequences B1Y7Y9
395495.Lcho_1463 WP_012346493.1.27902 gi|171058147|ref|YP_001790496.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]