SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171058210|ref|YP_001790559.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171058210|ref|YP_001790559.1|
Domain Number 1 Region: 180-367
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 7.32e-67
Family Methylesterase CheB, C-terminal domain 0.00000181
Further Details:      
 
Domain Number 2 Region: 4-107
Classification Level Classification E-value
Superfamily CheY-like 1.85e-28
Family CheY-related 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171058210|ref|YP_001790559.1|
Sequence length 370
Comment response regulator receiver modulated CheB methylesterase [Leptothrix cholodnii SP-6]
Sequence
MAAIRVMIVDDSAVVRKHLSDLLTAAGIEVIATAADPLFALPKMRARWPDVLVLDVEMPR
MDGISFLRQLMAERPTPVVMCSTLTEAGCETTLQALAAGAVSFVTKPRLGLRAFLEDGSN
GLVEAVRAAAGANLGAVMAGSKAVTVARAARAATSGAASAGGSGAAAARPRSDAMALTTD
RVIALGLSTGGVQSLERVLPFLPRTLPGMVVVQHMPEKFTAQFAARLDRICEVEVVEARN
GDRVINGRVLIAPGGRHLRLKRNGAQYVAEVMDGPLINHHRPSVDVLFRSVAQCAGRNAV
GLIMTGMGDDGCRGLREMRDAGAITAAQDEASSIVYGMPKEALRLGAAETVLGLDEIAGW
LVQAAQRKAA
Download sequence
Identical sequences B1XWC6
gi|171058210|ref|YP_001790559.1| 395495.Lcho_1526 WP_012346556.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]