SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171058258|ref|YP_001790607.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171058258|ref|YP_001790607.1|
Domain Number 1 Region: 469-630
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.1e-38
Family Histidine kinase 0.0045
Further Details:      
 
Domain Number 2 Region: 653-774
Classification Level Classification E-value
Superfamily CheY-like 7.4e-17
Family CheY-related 0.0021
Further Details:      
 
Domain Number 3 Region: 400-479
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000392
Family Homodimeric domain of signal transducing histidine kinase 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171058258|ref|YP_001790607.1|
Sequence length 777
Comment histidine kinase [Leptothrix cholodnii SP-6]
Sequence
MIAHRLPLPAPFDWPRHLLRCAAFFIGLMGLLLGSAAVANPPLALTQAHFSPRPGAPEQA
VELPDTWAQRGLPNRGAGIYRIVFELPVVPQQVWALRIDRLADQHEIRLNGALLSGRIDP
EAGKPPLSRATPTWIPVAPQMLRSGHNELQISVRYSTRAGLSPVWIGPAGPLWDDSLLEQ
RLEFLLPVMLNCGGSALGLFMVLLWWRRRSEVLIGTFGLVWLLISLRSTAYFTIYSAQQG
IVFDAFMYISQILSALLLGMASLILADRARHWWRRLLIGLAVPLMLLGIPAAALGEVDTL
RTFTYPLVLGAVIPPLVMVAISARRLQSRARLLMLTALLTLVVTAAHDYLGWRGELSVMS
RYWMPLMLPLVFSVFAWTLMQRMVNALEQVEQLNSDLELRVAERTRALEQANLTKTRFLA
AASHDLRQPVVAIGILIDLLREHIQVPAQRRMIDRVNDAVASMEALLKGLLDLSRLEAGT
VQPRFESIELQTLFDAIAAHVNEAAHQKGLKLRLRPTRLAVRSDRVLLEQIVRNLVSNAV
RYTERGGVLVAARQRGDRVVLQVWDSGHGIAADQQERIFDEFVQGAGRRNAEGNLGLGLG
LAIVRRAVQLLGHRLSLRSQPGRGSCFALGMDAAQARPGALRAAPSAARPLQDWRLALVD
DDDQVRAALAARLAAWGAEVESHASLTGFRQWLARHPRGRSGVDFLITDQRLIGATGLEV
IEALHSYAGPVPALVITGDTAPADLALLANSGVTVLHKPFRAEVLLAAIMQVRRAAP
Download sequence
Identical sequences B1XWH4
gi|171058258|ref|YP_001790607.1| WP_012346603.1.27902 395495.Lcho_1575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]