SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171058279|ref|YP_001790628.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171058279|ref|YP_001790628.1|
Domain Number 1 Region: 9-149
Classification Level Classification E-value
Superfamily CheY-like 6.55e-21
Family CheY-related 0.0074
Further Details:      
 
Domain Number 2 Region: 246-356
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00000000000288
Family Histidine kinase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|171058279|ref|YP_001790628.1|
Sequence length 385
Comment response regulator receiver sensor signal transduction histidine kinase [Leptothrix cholodnii SP-6]
Sequence
MQRQTKLRRVRILHLEDSELDHQLLLAHLRRGGIEPSMRRVDTEAEYMAALGHAWDAVIS
DYNLPGFSGLVALELLRERDKLMPFILVSGEIGEDTAVEAMRNGASDYLLKSNLARLVPA
LMHSVDACETQRARQRADHELAQSRRRLSELAQHLQTSIELERTAISREIHDDVGGSLTA
VKFDLAWIVRHAGNAQMIERAQQALETVNHAIEASQRIMHNLRPAILEQGLVAALQWMTQ
RFERRSGISTTFRTSHDHLRLPAGVPLVAYRTAQEALTNISKHARATRVQVDLTMAAGVL
SLEISDNGRGLGVGDLGKDRSFGIRGLHERADTVGGWVDLSGTPQGTTLILSVPLEQSAM
RHHDADDGGPPPPTSPHDPSTWGDL
Download sequence
Identical sequences B1XX82
395495.Lcho_1596 gi|171058279|ref|YP_001790628.1| WP_012346624.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]