SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171058336|ref|YP_001790685.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171058336|ref|YP_001790685.1|
Domain Number 1 Region: 148-248
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 7.09e-25
Family PhoB-like 0.0003
Further Details:      
 
Domain Number 2 Region: 10-141
Classification Level Classification E-value
Superfamily CheY-like 0.00000000000569
Family CheY-related 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171058336|ref|YP_001790685.1|
Sequence length 263
Comment two component transcriptional regulator [Leptothrix cholodnii SP-6]
Sequence
MQEPYSLPSRAPHRTLLLVIEEPAIRELLASSFRHAGFFPVLAASAADGHRLAGEVRPDV
VLIDLDTPATATFSIDQLQAGRSQPAPLLSVLLTARPQACGAQGELCGGSSGALCIAKPY
SPRELVARVLRELSTLNGRVQGRPSVRRLLRAGPLEIDPDQRRVTLRHAGGLVELDLAPT
EIKLLGCLMAHPDRVLSRDQLLALVWGEDGTTDPRTVDQNIRRLRRCFEAAGAGELIRTV
RGLGYRLTIAATPAATPGATAPR
Download sequence
Identical sequences B1XXD9
gi|171058336|ref|YP_001790685.1| 395495.Lcho_1653 WP_012346681.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]